Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein Laccase [49557] (5 species) consists of three domains of this fold |
Species Trametes versicolor, laccase 2 [TaxId:5325] [74872] (1 PDB entry) |
Domain d1gyca1: 1gyc A:1-130 [70748] complexed with cu, ipa, nag |
PDB Entry: 1gyc (more details), 1.9 Å
SCOPe Domain Sequences for d1gyca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} aigpaaslvvanapvspdgflrdaivvngvfpsplitgkkgdrfqlnvvdtltnhtmlks tsihwhgffqagtnwadgpafvnqcpiasghsflydfhvpdqagtfwyhshlstqycdgl rgpfvvydpk
Timeline for d1gyca1: