Class b: All beta proteins [48724] (176 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (5 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (44 PDB entries) |
Domain d3t4ma_: 3t4m A: [249777] automated match to d2ymea_ complexed with ca, mpd, mrd, nag |
PDB Entry: 3t4m (more details), 3 Å
SCOPe Domain Sequences for d3t4ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t4ma_ b.96.1.0 (A:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} kddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlv yweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqnalvthdg svqylpaqrlsfmcdptgvdseegatcavkfgswsysgfeidlktdtdqvdlssyyassk yeilsatqtrqvrfyecckepypdvnlvvkfrer
Timeline for d3t4ma_: