SCOPe 2.05: Domain d3sh1f_: 3sh1 F:

Lineage for d3sh1f_ (3sh1 F:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (44 PDB entries)

8. Domain d3sh1f_: 3sh1 F: [249445]
   automated match to d2ymea_
   complexed with act, mg, mlk, mpd, mrd, nag

Details for d3sh1f_

PDB Entry: 3sh1, 2.9 Å

PDB Description: ac-achbp ligand binding domain mutated to human alpha-7 nachr

PDB Compounds: (F:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3sh1f_:

Sequence; same for both SEQRES and ATOM records:

>d3sh1f_ b.96.1.0 (F:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
kddddklhsqanlmrlksdlfnrspmypgptkddpltvylsfslldivkadsstnevdlv
yweqqswklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqnalvnssg
hvqylpaqrlsfmcdptgvdseegatcavkfgswsyggweidlktdtdqvdlssyyassk
yeilsatqtrserfyecckepypdvnlvvkfrer

Timeline for d3sh1f_:

• d3sh1f_ first appeared in SCOPe 2.04
  
• d3sh1f_ is called d3sh1f1 in SCOPe 2.06
  
• d3sh1f_ appears in the current release, SCOPe 2.08, called d3sh1f1