Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (125 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries) |
Domain d3sepb3: 3sep B:334-625 [249404] Other proteins in same PDB: d3sepa1, d3sepa2, d3sepa4, d3sepa5, d3sepb1, d3sepb2, d3sepb4, d3sepb5, d3sepc1, d3sepc2, d3sepc4, d3sepc5, d3sepd1, d3sepd2, d3sepd4, d3sepd5 automated match to d1jz7a5 complexed with dms, mg, na |
PDB Entry: 3sep (more details), 2.05 Å
SCOPe Domain Sequences for d3sepb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sepb3 c.1.8.0 (B:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3sepb3:
View in 3D Domains from same chain: (mouse over for more information) d3sepb1, d3sepb2, d3sepb4, d3sepb5 |