Lineage for d3sepa4 (3sep A:626-730)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372926Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2372927Protein automated matches [254633] (16 species)
    not a true protein
  7. 2373010Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries)
  8. 2373076Domain d3sepa4: 3sep A:626-730 [249400]
    Other proteins in same PDB: d3sepa1, d3sepa3, d3sepa5, d3sepb1, d3sepb3, d3sepb5, d3sepc1, d3sepc3, d3sepc5, d3sepd1, d3sepd3, d3sepd5
    automated match to d1jz8a2
    complexed with dms, mg, na

Details for d3sepa4

PDB Entry: 3sep (more details), 2.05 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796a)
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3sepa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sepa4 b.1.4.0 (A:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d3sepa4:

Click to download the PDB-style file with coordinates for d3sepa4.
(The format of our PDB-style files is described here.)

Timeline for d3sepa4: