Lineage for d3seib2 (3sei B:72-142)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493398Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1493535Family a.60.1.0: automated matches [191306] (1 protein)
    not a true family
  6. 1493536Protein automated matches [190031] (2 species)
    not a true protein
  7. 1493541Species Human (Homo sapiens) [TaxId:9606] [188353] (18 PDB entries)
  8. 1493550Domain d3seib2: 3sei B:72-142 [249396]
    automated match to d1b4fg_
    complexed with cl, so4

Details for d3seib2

PDB Entry: 3sei (more details), 2.4 Å

PDB Description: Crystal Structure of Caskin1 Tandem SAMs
PDB Compounds: (B:) Caskin-1

SCOPe Domain Sequences for d3seib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3seib2 a.60.1.0 (B:72-142) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pehkpanlavwlsmiglaqyykvlvdngyenidfitditwedlqeigitklghqkklmla
vrklaelrrhh

SCOPe Domain Coordinates for d3seib2:

Click to download the PDB-style file with coordinates for d3seib2.
(The format of our PDB-style files is described here.)

Timeline for d3seib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3seib1