![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
![]() | Protein Heat-labile toxin [50205] (2 species) |
![]() | Species Escherichia coli, type IB [TaxId:562] [50206] (22 PDB entries) |
![]() | Domain d1lt6d_: 1lt6 D: [24925] complexed with gaa |
PDB Entry: 1lt6 (more details), 2.2 Å
SCOPe Domain Sequences for d1lt6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lt6d_ b.40.2.1 (D:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]} apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
Timeline for d1lt6d_: