Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily) possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) automatically mapped to Pfam PF01425 |
Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 proteins) |
Protein automated matches [191046] (2 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [188885] (20 PDB entries) |
Domain d3qj9b_: 3qj9 B: [248911] Other proteins in same PDB: d3qj9a2 automated match to d3oj8b_ complexed with edo, gol, pge, qj9 |
PDB Entry: 3qj9 (more details), 2.3 Å
SCOPe Domain Sequences for d3qj9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qj9b_ c.117.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} rqkargaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelsp eavfftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdst lglslnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwkssks pggssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygq tavqlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetd nytmpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfk gdfvdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiem yrqsviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvt aeddaqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt pqkq
Timeline for d3qj9b_: