Lineage for d3qbgd_ (3qbg D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022990Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 3022991Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 3023317Family f.13.1.0: automated matches [227143] (1 protein)
    not a true family
  6. 3023318Protein automated matches [226845] (25 species)
    not a true protein
  7. 3023498Species Natronomonas pharaonis [TaxId:2257] [256038] (6 PDB entries)
  8. 3023501Domain d3qbgd_: 3qbg D: [248846]
    automated match to d1e12a_
    complexed with 22b, bng, ret

Details for d3qbgd_

PDB Entry: 3qbg (more details), 1.8 Å

PDB Description: anion-free blue form of pharaonis halorhodopsin
PDB Compounds: (D:) halorhodopsin

SCOPe Domain Sequences for d3qbgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qbgd_ f.13.1.0 (D:) automated matches {Natronomonas pharaonis [TaxId: 2257]}
evtqrelfefvlndpllasslyinialaglsillfvfmtrglddprakliavstilvpvv
siasytglasgltisvlempaghfaegssvmlggeevdgvvtmwgryltwalstpmilla
lgllagsnatklftaitfdiamcvtglaaalttsshlmrwfwyaiscacfivvlyillve
waqdakaagtadifstlklltvvmwlgypivwalgvegvavlpvgytswaysaldivaky
ifaflllnyltsnegvvsgs

SCOPe Domain Coordinates for d3qbgd_:

Click to download the PDB-style file with coordinates for d3qbgd_.
(The format of our PDB-style files is described here.)

Timeline for d3qbgd_: