Lineage for d3pl5a_ (3pl5 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884965Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 1884966Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 1885013Family c.119.1.0: automated matches [191443] (1 protein)
    not a true family
  6. 1885014Protein automated matches [190655] (9 species)
    not a true protein
  7. 1885035Species Streptococcus mutans [TaxId:210007] [256022] (1 PDB entry)
  8. 1885036Domain d3pl5a_: 3pl5 A: [248519]
    automated match to d1pzxb_
    complexed with plm

Details for d3pl5a_

PDB Entry: 3pl5 (more details), 2.04 Å

PDB Description: Fatty acid binding protein
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3pl5a_:

Sequence, based on SEQRES records: (download)

>d3pl5a_ c.119.1.0 (A:) automated matches {Streptococcus mutans [TaxId: 210007]}
tfkiltdstadlpeswtqendvqvlgltvqldgityetvgpdrltsrvllekiaagskpt
tsqvnvgqfesyfrqsaengqevlyiafssvlsgtyqsavmardivleeypqasieivdt
laatggegylamlaaqareegkslketkelildvgprlrtfflvdnlyhlmrggrlskts
aivgslvnikpllwldasgklvpiaklrgrkkgmkemlkratadvahdtavvayandsea
aenlkeqllanekiknvvtlplgpvisthvgpntlavftigkear

Sequence, based on observed residues (ATOM records): (download)

>d3pl5a_ c.119.1.0 (A:) automated matches {Streptococcus mutans [TaxId: 210007]}
tfkiltdstadlpeswtqendvqvlgltvqldgityetvgpdrltsrvllekiaagskpt
tsqvnvgqfesyfrqsaengqevlyiafssvlsgtyqsavmardivleeypqasieivdt
laatggegylamlaaqareegkslketkelildvgprlrtfflvdnlyhlmrggrlslvn
ikpllwldasgklvpiaklrgrkkgmkemlkratadvahdtavvayandseaaenlkeql
lanekiknvvtlplgpvisthvgpntlavftigkear

SCOPe Domain Coordinates for d3pl5a_:

Click to download the PDB-style file with coordinates for d3pl5a_.
(The format of our PDB-style files is described here.)

Timeline for d3pl5a_: