Lineage for d3p4rb1 (3p4r B:1-105)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1894211Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 1894368Protein automated matches [231466] (4 species)
    not a true protein
  7. 1894390Species Escherichia coli [TaxId:216592] [256013] (2 PDB entries)
  8. 1894391Domain d3p4rb1: 3p4r B:1-105 [248414]
    Other proteins in same PDB: d3p4rb2, d3p4rc_, d3p4rn2, d3p4ro_
    automated match to d3p4pb1
    complexed with f3s, fad, fes, gua, sf4

Details for d3p4rb1

PDB Entry: 3p4r (more details), 3.05 Å

PDB Description: Crystal structure of Menaquinol:fumarate oxidoreductase in complex with glutarate
PDB Compounds: (B:) Fumarate reductase iron-sulfur subunit

SCOPe Domain Sequences for d3p4rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p4rb1 d.15.4.2 (B:1-105) automated matches {Escherichia coli [TaxId: 216592]}
aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvd

SCOPe Domain Coordinates for d3p4rb1:

Click to download the PDB-style file with coordinates for d3p4rb1.
(The format of our PDB-style files is described here.)

Timeline for d3p4rb1: