SCOPe 2.05: Domain d3ov6a2: 3ov6 A:8-184

Lineage for d3ov6a2 (3ov6 A:8-184)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries)

8. Domain d3ov6a2: 3ov6 A:8-184 [248353]
   Other proteins in same PDB: d3ov6a1, d3ov6a3
   automated match to d1onqa2
   complexed with d12, mk0, nag

Details for d3ov6a2

PDB Entry: 3ov6, 2.5 Å

PDB Description: cd1c in complex with mpm (mannosyl-beta1-phosphomycoketide)

PDB Compounds: (A:) Beta-2-microglobulin, T-cell surface glycoprotein CD1c, T-cell surface glycoprotein CD1b

SCOPe Domain Sequences for d3ov6a2:

Sequence, based on SEQRES records:

>d3ov6a2 d.19.1.0 (A:8-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsfhviqifsfvnqswargqgsgwldelqthgwdsesgtiiflhqwskgqfsneelsdle
llfrfylfgltreiqdhasqdyskypfevqvkagcelhsggspegffqvafngldllsfq
qttwvpspgcgslaqsvchllnhqyegvtetvynlirstcprfllglldagkmyvhr

Sequence, based on observed residues (ATOM records):

>d3ov6a2 d.19.1.0 (A:8-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsfhviqifsfvnqswargqgsgwldelqthgwdsesgtiiflhqwskgqfsneelsdle
llfrfylfgltreiqdhasskypfevqvkagcelhsggspegffqvafngldllsfqqtt
wvpspgcgslaqsvchllnhqyegvtetvynlirstcprfllglldagkmyvhr

Timeline for d3ov6a2:

• d3ov6a2 first appeared in SCOPe 2.04
  
• d3ov6a2 appears in SCOPe 2.06
  
• d3ov6a2 appears in the current release, SCOPe 2.08