Lineage for d3nuhb1 (3nuh B:402-561,B:733-784)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3020903Fold e.78: DNA gyrase B, C-terminal domain-like [254116] (1 superfamily)
    2 domains: (1) toprim alpha/beta; (2) alpha+beta "tail" domain
  4. 3020904Superfamily e.78.1: DNA gyrase B, C-terminal domain-like [254138] (1 family) (S)
    Pfam PF00986; homologous to Type II DNA topoisomerase N-terminal half
  5. 3020905Family e.78.1.1: DNA gyrase B, C-terminal domain [254182] (1 protein)
  6. 3020906Protein DNA gyrase beta-prime domain [254406] (3 species)
  7. 3020907Species Escherichia coli [TaxId:511693] [254844] (1 PDB entry)
  8. 3020908Domain d3nuhb1: 3nuh B:402-561,B:733-784 [248034]
    Other proteins in same PDB: d3nuha_, d3nuhb2
    complexed with mg

Details for d3nuhb1

PDB Entry: 3nuh (more details), 3.1 Å

PDB Description: A domain insertion in E. coli GyrB adopts a novel fold that plays a critical role in gyrase function
PDB Compounds: (B:) DNA gyrase subunit b

SCOPe Domain Sequences for d3nuhb1:

Sequence, based on SEQRES records: (download)

>d3nuhb1 e.78.1.1 (B:402-561,B:733-784) DNA gyrase beta-prime domain {Escherichia coli [TaxId: 511693]}
glpgkladcqerdpalselylvegdsaggsakqgrnrknqailplkgkilnvekarfdkm
lssqevatlitalgcgigrdeynpdklryhsiiimtdadvdgshirtllltffyrqmpei
verghvyiaqpplykvkkgkqeqyikddeamdqyqisialXglsiqrykglgemnpeqlw
ettmdpesrrmlrvtvkdaiaadqlfttlmgda

Sequence, based on observed residues (ATOM records): (download)

>d3nuhb1 e.78.1.1 (B:402-561,B:733-784) DNA gyrase beta-prime domain {Escherichia coli [TaxId: 511693]}
glpgkladcqerdpalselylvegdsaggsakqgrnrknqailplkglssqevatlital
gryhsiiimtdadvdgshirtllltffyrqmpeiverghvyiaqpplykvkkgkqeqyik
ddeamdqyqisialXglsiqrykglgemnpeqlwettmdpesrrmlrvtvkdaiaadqlf
ttlmgda

SCOPe Domain Coordinates for d3nuhb1:

Click to download the PDB-style file with coordinates for d3nuhb1.
(The format of our PDB-style files is described here.)

Timeline for d3nuhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nuhb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3nuha_