SCOPe 2.05: Domain d3ns1j1: 3ns1 J:2-92

Lineage for d3ns1j1 (3ns1 J:2-92)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein automated matches [231466] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232069] (9 PDB entries)

8. Domain d3ns1j1: 3ns1 J:2-92 [248007]
   Other proteins in same PDB: d3ns1a2, d3ns1b1, d3ns1b2, d3ns1c1, d3ns1c2, d3ns1j2, d3ns1k1, d3ns1k2, d3ns1l1, d3ns1l2
   automated match to d3etrl1
   complexed with fad, fes, mos, mte, pm6

Details for d3ns1j1

PDB Entry: 3ns1, 2.6 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with 6-Mercaptopurine

PDB Compounds: (J:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3ns1j1:

Sequence; same for both SEQRES and ATOM records:

>d3ns1j1 d.15.4.2 (J:2-92) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
qdkiihfsanaclapictlhhvavttvegig

Timeline for d3ns1j1:

• d3ns1j1 first appeared in SCOPe 2.04
  
• d3ns1j1 appears in SCOPe 2.06
  
• d3ns1j1 appears in the current release, SCOPe 2.08