Lineage for d2g3pa2 (2g3p A:90-224)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786604Fold b.37: N-terminal domains of the minor coat protein g3p [50175] (1 superfamily)
    core: barrel, in some members open; n*=4, S*=8; meander
  4. 1786605Superfamily b.37.1: N-terminal domains of the minor coat protein g3p [50176] (2 families) (S)
  5. 1786606Family b.37.1.1: N-terminal domains of the minor coat protein g3p [50177] (2 proteins)
  6. 1786607Protein N-terminal domains of the minor coat protein g3p [50178] (2 species)
    duplication: the two domains share a common fold
  7. 1786608Species Bacteriophage fd [TaxId:10864] [50180] (2 PDB entries)
  8. 1786610Domain d2g3pa2: 2g3p A:90-224 [24792]

Details for d2g3pa2

PDB Entry: 2g3p (more details), 1.9 Å

PDB Description: structure of the n-terminal two domains of the infectivity protein g3p of filamentous phage fd
PDB Compounds: (A:) infectivity protein g3p

SCOPe Domain Sequences for d2g3pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3pa2 b.37.1.1 (A:90-224) N-terminal domains of the minor coat protein g3p {Bacteriophage fd [TaxId: 10864]}
peygdtpipgytyinpldgtyppgteqnpanpnpsleesqplntfmfqnnrfrnrqgalt
vytgtvtqgtdpvktyyqytpvsskamydaywngkfrdcafhsgfnedpfvceyqgqssd
lpqppvnaaahhhhh

SCOPe Domain Coordinates for d2g3pa2:

Click to download the PDB-style file with coordinates for d2g3pa2.
(The format of our PDB-style files is described here.)

Timeline for d2g3pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g3pa1