SCOPe 2.05: Domain d1bfea_: 1bfe A:

Lineage for d1bfea_ (1bfe A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Synaptic protein PSD-95 [50162] (2 species)
   Synonym: synapse associated protein 90, sap90
   duplication: contains three PDZ domains

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50163] (8 PDB entries)
   Uniprot P31016 62-154

8. Domain d1bfea_: 1bfe A: [24775]
   third PDZ domain

Details for d1bfea_

PDB Entry: 1bfe, 2.3 Å

PDB Description: the third pdz domain from the synaptic protein psd-95

PDB Compounds: (A:) psd-95

SCOPe Domain Sequences for d1bfea_:

Sequence; same for both SEQRES and ATOM records:

>d1bfea_ b.36.1.1 (A:) Synaptic protein PSD-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dipreprrivihrgstglgfniiggedgegifisfilaggpadlsgelrkgdqilsvngv
dlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvnssgrivtn

Timeline for d1bfea_:

• d1bfea_ first appeared (with stable ids) in SCOP 1.55
  
• d1bfea_ appears in SCOPe 2.04
  
• d1bfea_ appears in SCOPe 2.06
  
• d1bfea_ appears in the current release, SCOPe 2.08