SCOPe 2.06: Domain d3m85e2: 3m85 E:154-250

Lineage for d3m85e2 (3m85 E:154-250)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families)

5. Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)

6. Protein automated matches [232896] (1 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [232897] (2 PDB entries)

8. Domain d3m85e2: 3m85 E:154-250 [247619]
   Other proteins in same PDB: d3m85d1, d3m85e1, d3m85f1, d3m85g1, d3m85g2, d3m85h1, d3m85h2, d3m85i1, d3m85i2
   automated match to d2ba1d2
   protein/RNA complex; complexed with zn

Details for d3m85e2

PDB Entry: 3m85, 3 Å

PDB Description: archaeoglobus fulgidus exosome y70a with rna bound to the active site

PDB Compounds: (E:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d3m85e2:

Sequence; same for both SEQRES and ATOM records:

>d3m85e2 d.101.1.1 (E:154-250) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
pmkgmitsvavgkadgqlvldpmkeednfgeadmpfaflirngkiesiallqmdgrmtrd
evkqaielakkgalqiyemqreailrryievgeemde

Timeline for d3m85e2:

• d3m85e2 first appeared in SCOPe 2.04
  
• d3m85e2 appears in SCOPe 2.05
  
• d3m85e2 appears in SCOPe 2.07
  
• d3m85e2 appears in the current release, SCOPe 2.08