SCOPe 2.05: Domain d1cdoa1: 1cdo A:1-164,A:340-374

Lineage for d1cdoa1 (1cdo A:1-164,A:340-374)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Cod (Gadus callarias) [TaxId:8053] [50141] (1 PDB entry)

8. Domain d1cdoa1: 1cdo A:1-164,A:340-374 [24747]
   Other proteins in same PDB: d1cdoa2, d1cdob2
   complexed with nad, zn

Details for d1cdoa1

PDB Entry: 1cdo, 2.05 Å

PDB Description: alcohol dehydrogenase (e.c.1.1.1.1) (ee isozyme) complexed with nicotinamide adenine dinucleotide (nad), and zinc

PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d1cdoa1:

Sequence; same for both SEQRES and ATOM records:

>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]}
atvgkvikckaavaweankplvieeievdvphaneirikiiatgvchtdlyhlfegkhkd
gfpvvlghegagivesvgpgvtefqpgekviplfisqcgecrfcqspktnqcvkgwanes
pdvmspketrftckgrkvlqflgtstfsqytvvnqiavakidpsXvkldefithrmples
vndaidlmkhgkcirtvlsl

Timeline for d1cdoa1:

• d1cdoa1 first appeared (with stable ids) in SCOP 1.55
  
• d1cdoa1 appears in SCOPe 2.04
  
• d1cdoa1 appears in SCOPe 2.06
  
• d1cdoa1 appears in the current release, SCOPe 2.08