SCOPe 2.05: Domain d3ld2a_: 3ld2 A:

Lineage for d3ld2a_ (3ld2 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (32 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:210007] [255927] (1 PDB entry)

8. Domain d3ld2a_: 3ld2 A: [247442]
   automated match to d2ae6c_
   complexed with coa

Details for d3ld2a_

PDB Entry: 3ld2, 2.5 Å

PDB Description: The Crystal Structure of smu.2055 from Streptococcus mutans UA159

PDB Compounds: (A:) putative acetyltransferase

SCOPe Domain Sequences for d3ld2a_:

Sequence; same for both SEQRES and ATOM records:

>d3ld2a_ d.108.1.0 (A:) automated matches {Streptococcus mutans [TaxId: 210007]}
smkispmllsdieqvvelenktwseqntpvplpvaskdqiiqkfesnthflvakikdkiv
gvldysslypfpsgqhivtfgiavaekerrkgigralvqiflnevksdyqkvlihvlssn
qeavlfykklgfdlearltkqfflkgqyvddliysydle

Timeline for d3ld2a_:

• d3ld2a_ first appeared in SCOPe 2.04
  
• d3ld2a_ is called d3ld2a1 in SCOPe 2.06
  
• d3ld2a_ appears in the current release, SCOPe 2.08, called d3ld2a1