Lineage for d1e3eb1 (1e3e B:4-167,B:342-376)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785402Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 1785403Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 1785524Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 1785545Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 1785705Species Mouse (Mus musculus), class II [TaxId:10090] [50140] (3 PDB entries)
  8. 1785711Domain d1e3eb1: 1e3e B:4-167,B:342-376 [24744]
    Other proteins in same PDB: d1e3ea2, d1e3eb2
    complexed with nai, zn

Details for d1e3eb1

PDB Entry: 1e3e (more details), 2.12 Å

PDB Description: mouse class ii alcohol dehydrogenase complex with nadh
PDB Compounds: (B:) alcohol dehydrogenase, class II

SCOPe Domain Sequences for d1e3eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3eb1 b.35.1.2 (B:4-167,B:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]}
gkvikckaaiawktgsplcieeievsppkacevriqviatcvcptdinatdpkkkalfpv
vlghecagivesvgpgvtnfkpgdkvipffapqckrcklclspltnlcgklrnfkyptid
qelmedrtsrftckgrsiyhfmgvssfsqytvvseanlarvddeXfdldllvthalpfes
indaidlmkegksirtiltf

SCOPe Domain Coordinates for d1e3eb1:

Click to download the PDB-style file with coordinates for d1e3eb1.
(The format of our PDB-style files is described here.)

Timeline for d1e3eb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e3eb2