Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins) |
Protein automated matches [232767] (3 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [232780] (8 PDB entries) |
Domain d3l73d1: 3l73 D:1-195 [247394] Other proteins in same PDB: d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d2, d3l73e1, d3l73e2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73t_, d3l73u_, d3l73w_ automated match to d3l71d1 complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq |
PDB Entry: 3l73 (more details), 3.04 Å
SCOPe Domain Sequences for d3l73d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l73d1 a.3.1.3 (D:1-195) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} gelelhppafpwshggplsaldhssvrrgfqvykqvcsachsmdyvafrnligvthteae akalaeevevqdgpdengelfmrpgkisdyfpkpypnpeaaraanngalppdlsyivnar hggedyvfslltgycdppagvvvreglhynpyfpgqaigmappiyneileyddgtpatms qiakdvctflrwaae
Timeline for d3l73d1:
View in 3D Domains from other chains: (mouse over for more information) d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73e1, d3l73e2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73t_, d3l73u_, d3l73w_ |