SCOPe 2.06: Domain d3l73d1: 3l73 D:1-195

Lineage for d3l73d1 (3l73 D:1-195)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)

6. Protein automated matches [232767] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [232780] (8 PDB entries)

8. Domain d3l73d1: 3l73 D:1-195 [247394]
   Other proteins in same PDB: d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d2, d3l73e1, d3l73e2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73t_, d3l73u_, d3l73w_
   automated match to d3l71d1
   complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq

Details for d3l73d1

PDB Entry: 3l73, 3.04 Å

PDB Description: cytochrome bc1 complex from chicken with triazolone inhibitor

PDB Compounds: (D:) Mitochondrial cytochrome c1, heme protein

SCOPe Domain Sequences for d3l73d1:

Sequence; same for both SEQRES and ATOM records:

>d3l73d1 a.3.1.3 (D:1-195) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gelelhppafpwshggplsaldhssvrrgfqvykqvcsachsmdyvafrnligvthteae
akalaeevevqdgpdengelfmrpgkisdyfpkpypnpeaaraanngalppdlsyivnar
hggedyvfslltgycdppagvvvreglhynpyfpgqaigmappiyneileyddgtpatms
qiakdvctflrwaae

Timeline for d3l73d1:

• d3l73d1 first appeared in SCOPe 2.04
  
• d3l73d1 appears in SCOPe 2.05
  
• d3l73d1 appears in SCOPe 2.07
  
• d3l73d1 appears in the current release, SCOPe 2.08