SCOPe 2.04: Domain d3l20b_: 3l20 B:

Lineage for d3l20b_ (3l20 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (16 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:367830] [255916] (1 PDB entry)

8. Domain d3l20b_: 3l20 B: [247328]
   automated match to d1u6la_

Details for d3l20b_

PDB Entry: 3l20, 2.45 Å

PDB Description: crystal structure of a hypothetical protein from staphylococcus aureus

PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3l20b_:

Sequence; same for both SEQRES and ATOM records:

>d3l20b_ d.32.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 367830]}
ymtalfpyiafenskealayyeevfgatdvkrlevgeeqashfgmtkeeaqeatmhaefe
vlgvkvlcsdsfgradkinngisllidydvnnkedadkveafyeqikdhssieielpfad
qfwggkmgvftdkygvrwmlhgqdy

Timeline for d3l20b_:

• d3l20b_ is new in SCOPe 2.04-stable
  
• d3l20b_ appears in SCOPe 2.05
  
• d3l20b_ appears in the current release, SCOPe 2.08, called d3l20b1