Lineage for d1u6la_ (1u6l A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase [110883] (4 proteins)
Pfam PF06983; both variants of dimeric assembly are observed in the family (domain swapping)
Protein Hypothetical protein PA1353 [117874] (1 species)
Family assignment by BLAST; HMM assignment is the Glyoxalase family (Pfam PF00903)Species Pseudomonas aeruginosa [TaxId:287] [117875] (1 PDB entry)
Uniprot Q9I3Z1
Domain d1u6la_: 1u6l A: [113067]
Structural genomics target
Details for d1u6la_
PDB Entry: 1u6l (more details), 2.81 Å
PDB Description: crystal structure of protein pa1353 from pseudomonas aeruginosa
PDB Compounds: (A:) hypothetical proteinSCOPe Domain Sequences for d1u6la_:
Sequence, based on SEQRES records: (download)
>d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]}
slqivpylifngncreafscyhqhlggtleamlpfgdspecgdipadwkdkimharlvvg
sfalmasdnhpaypyegikgcsislnvdskaeaerlfnalaeggsvqmplgptfwaasfg
mftdrfgvawmvnceqd
Sequence, based on observed residues (ATOM records): (download)
>d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]}
slqivpylifngncreafscyhqhlggtleamlpfgdspepadwkdkimharlvvgsfal
masdnhpaypyegikgcsislnvdskaeaerlfnalaeggsvqmplgptfwaasfgmftd
rfgvawmvnceqd
SCOPe Domain Coordinates for d1u6la_:
Click to download the PDB-style file with coordinates for d1u6la_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1u6la_:
- d1u6la_ first appeared in SCOP 1.71
- d1u6la_ appears in SCOPe 2.03
- d1u6la_ appears in SCOPe 2.05
- d1u6la_ appears in the current release, SCOPe 2.08, called d1u6la1
View in 3D
