Lineage for d1d1sc1 (1d1s C:1-162,C:339-374)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785402Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 1785403Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 1785524Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 1785545Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 1785650Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 1785693Domain d1d1sc1: 1d1s C:1-162,C:339-374 [24729]
    Other proteins in same PDB: d1d1sa2, d1d1sb2, d1d1sc2, d1d1sd2
    sigma isozyme
    complexed with act, cac, nad, zn

Details for d1d1sc1

PDB Entry: 1d1s (more details), 2.5 Å

PDB Description: wild-type human sigma (class iv) alcohol dehydrogenase
PDB Compounds: (C:) alcohol dehydrogenase class IV sigma chain

SCOPe Domain Sequences for d1d1sc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1sc1 b.35.1.2 (C:1-162,C:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
vladgttrftckgkpvhhfmntstfteytvvdessvakiddXkfdldqlithvlpfkkis
egfellnsgqsirtvltf

SCOPe Domain Coordinates for d1d1sc1:

Click to download the PDB-style file with coordinates for d1d1sc1.
(The format of our PDB-style files is described here.)

Timeline for d1d1sc1: