Lineage for d3ke1c_ (3ke1 C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914817Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 1914936Family d.79.5.0: automated matches [191525] (1 protein)
    not a true family
  6. 1914937Protein automated matches [190884] (7 species)
    not a true protein
  7. 1914948Species Burkholderia pseudomallei [TaxId:28450] [255823] (11 PDB entries)
  8. 1914969Domain d3ke1c_: 3ke1 C: [247145]
    automated match to d3re3a_
    complexed with 829, k, zn

Details for d3ke1c_

PDB Entry: 3ke1 (more details), 2.05 Å

PDB Description: crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with a fragment- nucleoside fusion d000161829
PDB Compounds: (C:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d3ke1c_:

Sequence, based on SEQRES records: (download)

>d3ke1c_ d.79.5.0 (C:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhfsdtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaa
dldlpldrvnvkaktneklgylgrgegieaqaaalvvre

Sequence, based on observed residues (ATOM records): (download)

>d3ke1c_ d.79.5.0 (C:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
mdfrigqgydvhqlvpgrpliiggvtipyergllgdadvllhaitdalfgaaalgdigrh
fdsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaadldlpldrvnvk
aktneklgylgrgegieaqaaalvvre

SCOPe Domain Coordinates for d3ke1c_:

Click to download the PDB-style file with coordinates for d3ke1c_.
(The format of our PDB-style files is described here.)

Timeline for d3ke1c_: