Lineage for d3k6wa_ (3k6w A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915693Species Methanosarcina acetivorans [TaxId:2214] [255905] (3 PDB entries)
  8. 2915696Domain d3k6wa_: 3k6w A: [247119]
    automated match to d2onke1
    complexed with moo, so4

Details for d3k6wa_

PDB Entry: 3k6w (more details), 2.45 Å

PDB Description: apo and ligand bound structures of moda from the archaeon methanosarcina acetivorans
PDB Compounds: (A:) Solute-binding protein MA_0280

SCOPe Domain Sequences for d3k6wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k6wa_ c.94.1.0 (A:) automated matches {Methanosarcina acetivorans [TaxId: 2214]}
evltvfhagslsvpfeeleaefeaqhpgvdvqreaagsaqsvrkitelgkkadvlasady
alipslmvpeyadwyaafarnqmilaytneskygdeintdnwyeilrrpdvrygfsnpnd
dpagyrsqmvtqlaesyynddmiyddlmlantgmtltteengtalihvpaseeispntsk
imlrsmevelssaletgeidylyiyrsvaeqhgfeyvalppaidlssleyadnyskvqve
mvngevvtgspivygvtipnnaenselatefvalllgetgqqifiengqppivpaiaegk
dsmpeelqalvv

SCOPe Domain Coordinates for d3k6wa_:

Click to download the PDB-style file with coordinates for d3k6wa_.
(The format of our PDB-style files is described here.)

Timeline for d3k6wa_: