Lineage for d3k2hb2 (3k2h B:205-511)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1923787Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1923788Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1924199Family d.117.1.0: automated matches [227244] (1 protein)
    not a true family
  6. 1924200Protein automated matches [227010] (6 species)
    not a true protein
  7. 1924201Species Babesia bovis [TaxId:484906] [232544] (3 PDB entries)
  8. 1924205Domain d3k2hb2: 3k2h B:205-511 [247101]
    Other proteins in same PDB: d3k2ha1, d3k2hb1
    automated match to d3i3ra2
    complexed with edo, lya, nap, ump

Details for d3k2hb2

PDB Entry: 3k2h (more details), 2.2 Å

PDB Description: co-crystal structure of dihydrofolate reductase/thymidylate synthase from babesia bovis with dump, pemetrexed and nadp
PDB Compounds: (B:) Dihydrofolate reductase/thymidylate synthase

SCOPe Domain Sequences for d3k2hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k2hb2 d.117.1.0 (B:205-511) automated matches {Babesia bovis [TaxId: 484906]}
gtdisvpkpkyvacpgvrirnheefqyldiladvlshgvlkpnrtgtdayskfgyqmrfd
lsrsfpllttkkvalrsiieellwfikgstngndllaknvriwelngrrdfldkngftdr
eehdlgpiygfqwrhfgaeyldmhadytgkgidqlaeiinriktnpndrrlivcswnvsd
lkkmalppchcffqfyvsdnklscmmhqrscdlglgvpfniasysiltamvaqvcglglg
efvhnladahiyvdhvdavttqiariphpfprlrlnpdirniedftiddivvedyvshpp
ipmamsa

SCOPe Domain Coordinates for d3k2hb2:

Click to download the PDB-style file with coordinates for d3k2hb2.
(The format of our PDB-style files is described here.)

Timeline for d3k2hb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3k2hb1