SCOPe 2.08: Domain d3k2ha2: 3k2h A:205-511

Lineage for d3k2ha2 (3k2h A:205-511)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.0: automated matches [227244] (1 protein)
   not a true family

6. Protein automated matches [227010] (5 species)
   not a true protein

7. Species Babesia bovis [TaxId:484906] [232544] (3 PDB entries)

8. Domain d3k2ha2: 3k2h A:205-511 [247099]
   Other proteins in same PDB: d3k2ha1, d3k2hb1
   automated match to d3i3ra2
   complexed with edo, lya, nap, ump

Details for d3k2ha2

PDB Entry: 3k2h, 2.2 Å

PDB Description: co-crystal structure of dihydrofolate reductase/thymidylate synthase from babesia bovis with dump, pemetrexed and nadp

PDB Compounds: (A:) Dihydrofolate reductase/thymidylate synthase

SCOPe Domain Sequences for d3k2ha2:

Sequence; same for both SEQRES and ATOM records:

>d3k2ha2 d.117.1.0 (A:205-511) automated matches {Babesia bovis [TaxId: 484906]}
gtdisvpkpkyvacpgvrirnheefqyldiladvlshgvlkpnrtgtdayskfgyqmrfd
lsrsfpllttkkvalrsiieellwfikgstngndllaknvriwelngrrdfldkngftdr
eehdlgpiygfqwrhfgaeyldmhadytgkgidqlaeiinriktnpndrrlivcswnvsd
lkkmalppchcffqfyvsdnklscmmhqrscdlglgvpfniasysiltamvaqvcglglg
efvhnladahiyvdhvdavttqiariphpfprlrlnpdirniedftiddivvedyvshpp
ipmamsa

Timeline for d3k2ha2:

• d3k2ha2 first appeared in SCOPe 2.04
  
• d3k2ha2 appears in SCOPe 2.07