Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.0: automated matches [227244] (1 protein) not a true family |
Protein automated matches [227010] (5 species) not a true protein |
Species Babesia bovis [TaxId:484906] [232544] (3 PDB entries) |
Domain d3k2ha2: 3k2h A:205-511 [247099] Other proteins in same PDB: d3k2ha1, d3k2hb1 automated match to d3i3ra2 complexed with edo, lya, nap, ump |
PDB Entry: 3k2h (more details), 2.2 Å
SCOPe Domain Sequences for d3k2ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k2ha2 d.117.1.0 (A:205-511) automated matches {Babesia bovis [TaxId: 484906]} gtdisvpkpkyvacpgvrirnheefqyldiladvlshgvlkpnrtgtdayskfgyqmrfd lsrsfpllttkkvalrsiieellwfikgstngndllaknvriwelngrrdfldkngftdr eehdlgpiygfqwrhfgaeyldmhadytgkgidqlaeiinriktnpndrrlivcswnvsd lkkmalppchcffqfyvsdnklscmmhqrscdlglgvpfniasysiltamvaqvcglglg efvhnladahiyvdhvdavttqiariphpfprlrlnpdirniedftiddivvedyvshpp ipmamsa
Timeline for d3k2ha2: