Lineage for d3izbu_ (3izb U:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3044140Family i.1.1.3: Small subunit [58132] (3 proteins)
  6. 3044141Protein Eukaryotic, cytoplasmic (40S subunit) [254422] (2 species)
  7. 3044142Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [254865] (1 PDB entry)
  8. 3044161Domain d3izbu_: 3izb U: [247015]

Details for d3izbu_

PDB Entry: 3izb (more details), 8.8 Å

PDB Description: Localization of the small subunit ribosomal proteins into a 6.1 A cryo-EM map of Saccharomyces cerevisiae translating 80S ribosome
PDB Compounds: (U:) 40S ribosomal protein S24

SCOPe Domain Sequences for d3izbu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3izbu_ i.1.1.3 (U:) Eukaryotic, cytoplasmic (40S subunit) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msdavtirtrkvisnpllarkqfvvdvlhpnranvskdelreklaevykaekdavsvfgf
rtqfgggksvgfglvynsvaeakkfeptyrlvrygl

SCOPe Domain Coordinates for d3izbu_:

Click to download the PDB-style file with coordinates for d3izbu_.
(The format of our PDB-style files is described here.)

Timeline for d3izbu_: