Lineage for d1ldyd1 (1ldy D:1-163,D:340-374)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785402Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 1785403Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 1785524Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 1785545Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 1785562Species Horse (Equus caballus) [TaxId:9796] [50138] (41 PDB entries)
    Uniprot P00327
  8. 1785641Domain d1ldyd1: 1ldy D:1-163,D:340-374 [24698]
    Other proteins in same PDB: d1ldya2, d1ldyb2, d1ldyc2, d1ldyd2
    complexed with cxf, nad, zn

Details for d1ldyd1

PDB Entry: 1ldy (more details), 2.5 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and cyclohexyl formamide (cxf)
PDB Compounds: (D:) alcohol dehydrogenase

SCOPe Domain Sequences for d1ldyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldyd1 b.35.1.2 (D:1-163,D:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOPe Domain Coordinates for d1ldyd1:

Click to download the PDB-style file with coordinates for d1ldyd1.
(The format of our PDB-style files is described here.)

Timeline for d1ldyd1: