Class b: All beta proteins [48724] (176 folds) |
Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) |
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
Protein Alcohol dehydrogenase [50137] (9 species) contains a Zn-finger subdomain, residues 94-117 |
Species Horse (Equus caballus) [TaxId:9796] [50138] (41 PDB entries) Uniprot P00327 |
Domain d1adbb1: 1adb B:1-163,B:340-374 [24684] Other proteins in same PDB: d1adba2, d1adbb2 complexed with cnd, eoh, zn |
PDB Entry: 1adb (more details), 2.4 Å
SCOPe Domain Sequences for d1adbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adbb1 b.35.1.2 (B:1-163,B:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki negfdllrsgesirtiltf
Timeline for d1adbb1: