![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein automated matches [190043] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187799] (39 PDB entries) |
![]() | Domain d3i5sb_: 3i5s B: [246722] automated match to d1pnja_ complexed with so4 |
PDB Entry: 3i5s (more details), 3 Å
SCOPe Domain Sequences for d3i5sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i5sb_ b.34.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} egyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqearpeeigwlngynett gergdfpgtyveyigrk
Timeline for d3i5sb_: