Lineage for d3i3dd2 (3i3d D:220-333)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521823Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1521824Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1521825Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 1521839Species Escherichia coli [TaxId:562] [49306] (41 PDB entries)
    Uniprot P00722
  8. 1521982Domain d3i3dd2: 3i3d D:220-333 [246685]
    Other proteins in same PDB: d3i3da1, d3i3da3, d3i3da5, d3i3db1, d3i3db3, d3i3db5, d3i3dc1, d3i3dc3, d3i3dc5, d3i3dd1, d3i3dd3, d3i3dd5
    automated match to d1jz8a1
    complexed with dms, ipt, mg, na

Details for d3i3dd2

PDB Entry: 3i3d (more details), 2.2 Å

PDB Description: e. coli (lacz) beta-galactosidase (m542a) in complex with iptg
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d3i3dd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3dd2 b.1.4.1 (D:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d3i3dd2:

Click to download the PDB-style file with coordinates for d3i3dd2.
(The format of our PDB-style files is described here.)

Timeline for d3i3dd2: