Lineage for d3hqwa_ (3hqw A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1508295Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1508296Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1508691Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 1508692Protein automated matches [190983] (6 species)
    not a true protein
  7. 1508803Species Norway rat (Rattus norvegicus) [TaxId:10116] [255521] (11 PDB entries)
  8. 1508805Domain d3hqwa_: 3hqw A: [246524]
    automated match to d4lm1a_
    complexed with mg, pf4, zn

Details for d3hqwa_

PDB Entry: 3hqw (more details), 1.7 Å

PDB Description: discovery of novel inhibitors of pde10a
PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d3hqwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hqwa_ a.211.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
paricrdielfhfdigpfenmwpgifvymihrscgtscfeleklcrfimsvkknyrrvpy
hnwkhavtvahcmyailqnnnglftdlerkglliaclchdldhrgfsnsylqkfdhplaa
lyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnrkq
leemyqtgslnlhnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegdemk
klgiqpipmmdrdkrdevpqgqlgfynavaipcyttltqilpptepllkacrdnlnqwek
vir

SCOPe Domain Coordinates for d3hqwa_:

Click to download the PDB-style file with coordinates for d3hqwa_.
(The format of our PDB-style files is described here.)

Timeline for d3hqwa_: