Class a: All alpha proteins [46456] (285 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (6 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [255521] (11 PDB entries) |
Domain d3hqwa_: 3hqw A: [246524] automated match to d4lm1a_ complexed with mg, pf4, zn |
PDB Entry: 3hqw (more details), 1.7 Å
SCOPe Domain Sequences for d3hqwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hqwa_ a.211.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} paricrdielfhfdigpfenmwpgifvymihrscgtscfeleklcrfimsvkknyrrvpy hnwkhavtvahcmyailqnnnglftdlerkglliaclchdldhrgfsnsylqkfdhplaa lyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnrkq leemyqtgslnlhnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegdemk klgiqpipmmdrdkrdevpqgqlgfynavaipcyttltqilpptepllkacrdnlnqwek vir
Timeline for d3hqwa_: