SCOPe 2.05: Domain d3h5qa3: 3h5q A:331-433

Lineage for d3h5qa3 (3h5q A:331-433)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families)

5. Family d.41.3.0: automated matches [254277] (1 protein)
   not a true family

6. Protein automated matches [254643] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [255860] (1 PDB entry)

8. Domain d3h5qa3: 3h5q A:331-433 [246471]
   Other proteins in same PDB: d3h5qa1, d3h5qa2
   automated match to d1brwa3
   complexed with so4, thm

Details for d3h5qa3

PDB Entry: 3h5q, 1.94 Å

PDB Description: crystal structure of a putative pyrimidine-nucleoside phosphorylase from staphylococcus aureus

PDB Compounds: (A:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d3h5qa3:

Sequence; same for both SEQRES and ATOM records:

>d3h5qa3 d.41.3.0 (A:331-433) automated matches {Staphylococcus aureus [TaxId: 93062]}
qaqyqieykakksgyvtelvsndigvasmmlgagrltkeddidlavgivlnkkigdkvee
geslltihsnrqdvddvvkkldssitiadhvvsptlihkiite

Timeline for d3h5qa3:

• d3h5qa3 first appeared in SCOPe 2.04
  
• d3h5qa3 appears in SCOPe 2.06
  
• d3h5qa3 appears in the current release, SCOPe 2.08