Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) |
Domain d3g6je2: 3g6j E:107-214 [246237] Other proteins in same PDB: d3g6je1, d3g6jg1 automated match to d1dn0a2 complexed with ca |
PDB Entry: 3g6j (more details), 3.1 Å
SCOPe Domain Sequences for d3g6je2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g6je2 b.1.1.2 (E:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d3g6je2: