SCOPe 2.04: Domain d3g0za_: 3g0z A:

Lineage for d3g0za_ (3g0z A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (26 species)
   not a true protein

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [255540] (3 PDB entries)

8. Domain d3g0za_: 3g0z A: [246226]
   automated match to d2d5ra1
   complexed with mn, zn

Details for d3g0za_

PDB Entry: 3g0z, 2 Å

PDB Description: structure of s. pombe pop2p - zn2+ and mn2+ bound form

PDB Compounds: (A:) CCR4-Not complex subunit Caf1

SCOPe Domain Sequences for d3g0za_:

Sequence; same for both SEQRES and ATOM records:

>d3g0za_ c.55.3.0 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
spirdvwstnlqqemnlimslierypvvsmdtefpgvvarplgvfkssddyhyqtlranv
dslkiiqiglalsdeegnapveactwqfnftfnlqddmyapesielltksgidfkkhqev
giepadfaelligsglvlqeevtwitfhsgydfayllkamtqiplpaeyeefykilciyf
pknydikyimksvlnnskglqdiaddlqihrigpqhqagsdalltariffeirsryfdgs
idsrmlnqlygl

Timeline for d3g0za_:

• d3g0za_ is new in SCOPe 2.04-stable
  
• d3g0za_ appears in SCOPe 2.05
  
• d3g0za_ appears in the current release, SCOPe 2.08