Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
Protein automated matches [227004] (3 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [225673] (5 PDB entries) |
Domain d3eteb1: 3ete B:4-208 [245908] Other proteins in same PDB: d3etea2, d3eteb2, d3etec2, d3eted2, d3etee2, d3etef2 automated match to d3etda1 complexed with glu, gtp, h3p, ndp |
PDB Entry: 3ete (more details), 3 Å
SCOPe Domain Sequences for d3eteb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eteb1 c.58.1.1 (B:4-208) automated matches {Cow (Bos taurus) [TaxId: 9913]} eddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvlslsf pirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfg gakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswiadty astighydinahacvtgkpisqggi
Timeline for d3eteb1: