Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein automated matches [190099] (19 species) not a true protein |
Species Flavobacterium sp. [TaxId:197856] [255816] (5 PDB entries) |
Domain d3edfb2: 3edf B:96-517 [245841] Other proteins in same PDB: d3edfa1, d3edfa3, d3edfb1, d3edfb3 automated match to d1h3ga3 complexed with acx, ca, ce6, gol |
PDB Entry: 3edf (more details), 1.65 Å
SCOPe Domain Sequences for d3edfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3edfb2 c.1.8.1 (B:96-517) automated matches {Flavobacterium sp. [TaxId: 197856]} gsaqrqgfgpgdaiyqimpdrfangdpsndnvagmreqadrrhgggrhggdirgtidhld yiaglgftqlwptplvendaaaysyhgyaatdhyridprygsnedfvrlstearkrgmgl iqdvvlshigkhhwwmkdlptpdwinyggkfvptqhhrvavqdpyaaqadsenftkgwfv egmpdlnqtnplvanyliqnniwwieyaglsglridtygysdgaflteytrrlmaeyprl nmvgqewstrvpvvarwqrgkanfdgytshlpslmdfplvdamrnalsktgeenglnevy etlsldylypepqnlvlfggnhdmarmfsaagedfdrwrmnlvflmtmpripqfysgdei lmtstvkgrddasyrrdfpggwagdkanafsgagltsqqraaqdlvrklanwrknqpvih ng
Timeline for d3edfb2: