Lineage for d1br1e1 (1br1 E:34-79)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165384Fold b.34: SH3-like barrel [50036] (10 superfamilies)
  4. 165618Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 165619Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 165620Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 165626Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [50087] (4 PDB entries)
  8. 165636Domain d1br1e1: 1br1 E:34-79 [24566]
    Other proteins in same PDB: d1br1a2, d1br1b_, d1br1c2, d1br1d_, d1br1e2, d1br1f_, d1br1g2, d1br1h_

Details for d1br1e1

PDB Entry: 1br1 (more details), 3.5 Å

PDB Description: smooth muscle myosin motor domain-essential light chain complex with mgadp.alf4 bound at the active site

SCOP Domain Sequences for d1br1e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1br1e1 b.34.3.1 (E:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle}
lvwvpsekhgfeaasikeekgdevtvelqengkkvtlskddiqkmn

SCOP Domain Coordinates for d1br1e1:

Click to download the PDB-style file with coordinates for d1br1e1.
(The format of our PDB-style files is described here.)

Timeline for d1br1e1: