Lineage for d3d2ra2 (3d2r A:181-397)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213592Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2213593Protein automated matches [226867] (14 species)
    not a true protein
  7. 2213640Species Human (Homo sapiens) [TaxId:9606] [225008] (12 PDB entries)
  8. 2213649Domain d3d2ra2: 3d2r A:181-397 [245605]
    Other proteins in same PDB: d3d2ra1, d3d2rb1
    automated match to d2bu8a2
    complexed with adp, gol, mg

Details for d3d2ra2

PDB Entry: 3d2r (more details), 2.03 Å

PDB Description: Crystal structure of pyruvate dehydrogenase kinase isoform 4 in complex with ADP
PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4

SCOPe Domain Sequences for d3d2ra2:

Sequence, based on SEQRES records: (download)

>d3d2ra2 d.122.1.0 (A:181-397) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdsqtgnpshigsidpncdvvavvqdafecsrmlcdqyylsspelkltqvngkfpdqpih
ivyvpshlhhmlfelfknamratvehqenqpsltpievivvlgkedltikisdrgggvpl
riidrlfsytystaptpvmdnsrnaplagfgyglpisrlyakyfqgdlnlyslsgygtda
iiylkalssesieklpvfnksafkhyqmsseaddwci

Sequence, based on observed residues (ATOM records): (download)

>d3d2ra2 d.122.1.0 (A:181-397) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdshigsidpncdvvavvqdafecsrmlcdqyylsspelkltqvngkfpdqpihivyvps
hlhhmlfelfknamratvehqenqpsltpievivvlgkedltikisdrgggvplriidrl
fsytystaptaplagfgyglpisrlyakyfqgdlnlyslsgygtdaiiylkalssesiek
lpvfnksafkhyddwci

SCOPe Domain Coordinates for d3d2ra2:

Click to download the PDB-style file with coordinates for d3d2ra2.
(The format of our PDB-style files is described here.)

Timeline for d3d2ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d2ra1