Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.29: Macroglobulin [254121] (8 families) C3 MG domains possibly arose by gene duplication according to PubMed 16177781; PubMed 17608619; possibly related to immunoglobulins according to Pfam clan annotations |
Family b.1.29.4: Complement C3 MG3-like [254157] (2 proteins) |
Protein Complement C5 MG3 [254353] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [254786] (1 PDB entry) |
Domain d3cu7b3: 3cu7 B:223-348 [245549] Other proteins in same PDB: d3cu7a1, d3cu7a2, d3cu7a4, d3cu7a5, d3cu7a6, d3cu7a7, d3cu7a8, d3cu7a9, d3cu7aa, d3cu7ab, d3cu7ac, d3cu7ad, d3cu7ae, d3cu7af, d3cu7b1, d3cu7b2, d3cu7b4, d3cu7b5, d3cu7b6, d3cu7b7, d3cu7b8, d3cu7b9, d3cu7ba, d3cu7bb, d3cu7bc, d3cu7bd, d3cu7be complexed with cd, nag |
PDB Entry: 3cu7 (more details), 3.11 Å
SCOPe Domain Sequences for d3cu7b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cu7b3 b.1.29.4 (B:223-348) Complement C5 MG3 {Human (Homo sapiens) [TaxId: 9606]} vlphfsvsiepeynfigyknfknfeitikaryfynkvvteadvyitfgiredlkddqkem mqtamqntmlingiaqvtfdsetavkelsyysledlnnkylyiavtviestggfseeaei pgikyv
Timeline for d3cu7b3: