SCOPe 2.07: Domain d3cu7aa: 3cu7 A:679-743

Lineage for d3cu7aa (3cu7 A:679-743)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family)

5. Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
   can be classified as disulfide-rich
   Pfam PF01821

6. Protein C5a anaphylotoxin [47688] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47689] (5 PDB entries)

8. Domain d3cu7aa: 3cu7 A:679-743 [245541]
   Other proteins in same PDB: d3cu7a1, d3cu7a2, d3cu7a3, d3cu7a4, d3cu7a5, d3cu7a6, d3cu7a7, d3cu7a8, d3cu7a9, d3cu7ab, d3cu7ac, d3cu7ad, d3cu7ae, d3cu7af, d3cu7b1, d3cu7b2, d3cu7b3, d3cu7b4, d3cu7b5, d3cu7b6, d3cu7b7, d3cu7b8, d3cu7b9, d3cu7bb, d3cu7bc, d3cu7bd, d3cu7be
   complexed with cd, nag

Details for d3cu7aa

PDB Entry: 3cu7, 3.11 Å

PDB Description: human complement component 5

PDB Compounds: (A:) Complement C5

SCOPe Domain Sequences for d3cu7aa:

Sequence; same for both SEQRES and ATOM records:

>d3cu7aa a.50.1.1 (A:679-743) C5a anaphylotoxin {Human (Homo sapiens) [TaxId: 9606]}
lqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasql
ranis

Timeline for d3cu7aa:

• d3cu7aa first appeared in SCOPe 2.04
  
• d3cu7aa appears in SCOPe 2.06
  
• d3cu7aa appears in the current release, SCOPe 2.08