Lineage for d3cqoa2 (3cqo A:151-293)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530952Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1530953Protein automated matches [190770] (24 species)
    not a true protein
  7. 1531130Species Morone saxatilis [TaxId:34816] [255778] (1 PDB entry)
  8. 1531132Domain d3cqoa2: 3cqo A:151-293 [245519]
    automated match to d3le0a_
    complexed with ca, cl, fuc

Details for d3cqoa2

PDB Entry: 3cqo (more details), 2.32 Å

PDB Description: Crystal structure of a f-lectin (fucolectin) from morone saxatilis (striped bass) serum
PDB Compounds: (A:) fbp32

SCOPe Domain Sequences for d3cqoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cqoa2 b.18.1.0 (A:151-293) automated matches {Morone saxatilis [TaxId: 34816]}
genlalkgkatqsslfesgiaynaidgnqannwemascthtkntmdpwwrmdlsqthrvf
svkvtnrdsfekringaeirigdsldnngnhnprcavitsipagastefqcngmdgryvn
ivipgreeyltlcevevygsvld

SCOPe Domain Coordinates for d3cqoa2:

Click to download the PDB-style file with coordinates for d3cqoa2.
(The format of our PDB-style files is described here.)

Timeline for d3cqoa2: