PDB entry 3cqo

View 3cqo on RCSB PDB site
Description: Crystal structure of a f-lectin (fucolectin) from morone saxatilis (striped bass) serum
Class: sugar binding protein
Keywords: f-lectin, fucolectin, sugar binding protein
Deposited on 2008-04-03, released 2009-04-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.184
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fbp32
    Species: Morone saxatilis [TaxId:34816]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2LK81 (0-292)
      • see remark 999 (45)
      • see remark 999 (89)
      • see remark 999 (156)
      • see remark 999 (195)
      • see remark 999 (204)
      • see remark 999 (240)
    Domains in SCOPe 2.04: d3cqoa1, d3cqoa2
  • Chain 'B':
    Compound: fbp32
    Species: Morone saxatilis [TaxId:34816]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2LK81 (0-292)
      • see remark 999 (45)
      • see remark 999 (89)
      • see remark 999 (156)
      • see remark 999 (195)
      • see remark 999 (204)
      • see remark 999 (240)
    Domains in SCOPe 2.04: d3cqob1, d3cqob2
  • Chain 'C':
    Compound: fbp32
    Species: Morone saxatilis [TaxId:34816]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2LK81 (0-292)
      • see remark 999 (45)
      • see remark 999 (89)
      • see remark 999 (156)
      • see remark 999 (195)
      • see remark 999 (204)
      • see remark 999 (240)
    Domains in SCOPe 2.04: d3cqoc1, d3cqoc2
  • Heterogens: FUC, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cqoA (A:)
    ynyknvalrgkatqsarylhthgaaynaidgnrnsdfeagscthtveqtnpwwrvdllep
    yivtsititnrgdccperlngveihignslqengvanprvgvishipagishtisfterv
    egryvtvllpgtnkvltlcevevhgyraptgenlalkgkatqsslfesgiaynaidgnqa
    nnwemascthtkntmdpwwrmdlsqthrvfsvkvtnrdsfekringaeirigdsldnngn
    hnprcavitsipagastefqcngmdgryvnivipgreeyltlcevevygsvld
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cqoB (B:)
    ynyknvalrgkatqsarylhthgaaynaidgnrnsdfeagscthtveqtnpwwrvdllep
    yivtsititnrgdccperlngveihignslqengvanprvgvishipagishtisfterv
    egryvtvllpgtnkvltlcevevhgyraptgenlalkgkatqsslfesgiaynaidgnqa
    nnwemascthtkntmdpwwrmdlsqthrvfsvkvtnrdsfekringaeirigdsldnngn
    hnprcavitsipagastefqcngmdgryvnivipgreeyltlcevevygsvld
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cqoC (C:)
    ynyknvalrgkatqsarylhthgaaynaidgnrnsdfeagscthtveqtnpwwrvdllep
    yivtsititnrgdccperlngveihignslqengvanprvgvishipagishtisfterv
    egryvtvllpgtnkvltlcevevhgyraptgenlalkgkatqsslfesgiaynaidgnqa
    nnwemascthtkntmdpwwrmdlsqthrvfsvkvtnrdsfekringaeirigdsldnngn
    hnprcavitsipagastefqcngmdgryvnivipgreeyltlcevevygsvld