Lineage for d3ck5b2 (3ck5 B:130-362)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2098969Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2099417Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2099418Protein automated matches [226923] (74 species)
    not a true protein
  7. 2099954Species Streptomyces coelicolor [TaxId:100226] [231096] (3 PDB entries)
  8. 2099964Domain d3ck5b2: 3ck5 B:130-362 [245498]
    Other proteins in same PDB: d3ck5a1, d3ck5a3, d3ck5b1, d3ck5b3, d3ck5c1, d3ck5c3, d3ck5d1, d3ck5d3
    automated match to d3bjsa2
    complexed with mg

Details for d3ck5b2

PDB Entry: 3ck5 (more details), 2.3 Å

PDB Description: crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
PDB Compounds: (B:) Putative racemase

SCOPe Domain Sequences for d3ck5b2:

Sequence, based on SEQRES records: (download)

>d3ck5b2 c.1.11.0 (B:130-362) automated matches {Streptomyces coelicolor [TaxId: 100226]}
ydpvvpvyaggidlelpvadlktqadrflaggfraikmkvgrpdlkedvdrvsalrehlg
dsfplmvdanmkwtvdgairaaralapfdlhwieeptipddlvgnarivresghtiagge
nlhtlydfhnavragsltlpepdvsniggyttfrkvaalaeannmlltshgvhdltvhal
asvphrtymeahgfglhaymaepmavtdgcvsapdrpghgvvldferlgrlav

Sequence, based on observed residues (ATOM records): (download)

>d3ck5b2 c.1.11.0 (B:130-362) automated matches {Streptomyces coelicolor [TaxId: 100226]}
ydpvvpvyaggidlelpvadlktqadrflaggfraikmkvgrpdlkedvdrvsalrehlg
dsfplmvdanmkwtvdgairaaralapfdlhwieeptipddlvgnarivresghtiagge
nlhtlydfhnavragsltlpepdvsniggyttfrkvaalaeannmlltshgvhdltvhal
asvphrtymeahlhaymaepmavtdgcvsapdrpghgvvldferlgrlav

SCOPe Domain Coordinates for d3ck5b2:

Click to download the PDB-style file with coordinates for d3ck5b2.
(The format of our PDB-style files is described here.)

Timeline for d3ck5b2: