SCOPe 2.05: Domain d3c84a_: 3c84 A:

Lineage for d3c84a_ (3c84 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (44 PDB entries)

8. Domain d3c84a_: 3c84 A: [245470]
   automated match to d2c9ta_
   complexed with ipa, mg, th4

Details for d3c84a_

PDB Entry: 3c84, 1.94 Å

PDB Description: Crystal structure of a complex of AChBP from aplysia californica and the neonicotinoid thiacloprid

PDB Compounds: (A:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3c84a_:

Sequence; same for both SEQRES and ATOM records:

>d3c84a_ b.96.1.0 (A:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
dklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeq
qrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmf
ipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeil
satqtrqvqhysccpepyidvnlvvkfrer

Timeline for d3c84a_:

• d3c84a_ first appeared in SCOPe 2.04
  
• d3c84a_ is called d3c84a1 in SCOPe 2.06
  
• d3c84a_ appears in the current release, SCOPe 2.08, called d3c84a1