SCOPe 2.07: Domain d3bpob1: 3bpo B:2-96

Lineage for d3bpob1 (3bpo B:2-96)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (32 PDB entries)

8. Domain d3bpob1: 3bpo B:2-96 [245390]
   Other proteins in same PDB: d3bpoa_, d3bpob3
   automated match to d3bplb1
   complexed with nag

Details for d3bpob1

PDB Entry: 3bpo, 3 Å

PDB Description: crystal structure of the il13-il4r-il13ra ternary complex

PDB Compounds: (B:) Interleukin-4 receptor alpha chain

SCOPe Domain Sequences for d3bpob1:

Sequence; same for both SEQRES and ATOM records:

>d3bpob1 b.1.2.1 (B:2-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvlqeptcvsdymsistcewkmngptqcstelrllyqlvfllseahtcipennggagcvc
hllmddvvsadqytldlwagqqllwkgsfkpsehv

Timeline for d3bpob1:

• d3bpob1 first appeared in SCOPe 2.04
  
• d3bpob1 appears in SCOPe 2.06
  
• d3bpob1 appears in the current release, SCOPe 2.08