Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.31: Fibronectin III-like [254143] (2 families) Pfam PF14310; PubMed 20138890; unclear if related to Fibronectin type III (b.1.2) |
Family b.1.31.1: Fibronectin III-like [254189] (1 protein) |
Protein Beta-glucosidase C-terminal domain [254418] (2 species) |
Species Kluyveromyces marxianus [TaxId:4911] [254860] (2 PDB entries) |
Domain d3abzd4: 3abz D:721-845 [245099] Other proteins in same PDB: d3abza1, d3abza2, d3abza3, d3abzb1, d3abzb2, d3abzb3, d3abzc1, d3abzc2, d3abzc3, d3abzd1, d3abzd2, d3abzd3 automated match to d3abza4 complexed with gol |
PDB Entry: 3abz (more details), 2.15 Å
SCOPe Domain Sequences for d3abzd4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abzd4 b.1.31.1 (D:721-845) Beta-glucosidase C-terminal domain {Kluyveromyces marxianus [TaxId: 4911]} ttfeldisdfkvtddkiaisvdvkntgdkfagsevvqvyfsalnskvsrpvkelkgfekv hlepgekktvnidlelkdaisyfneelgkwhveageylvsvgtssddilsvkefkvekel ywkgl
Timeline for d3abzd4: