Lineage for d3a7ad_ (3a7a D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426782Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2426783Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 2426828Protein Protein H of glycine cleavage system [51236] (4 species)
  7. 2426829Species Escherichia coli K-12 [TaxId:83333] [189182] (6 PDB entries)
  8. 2426839Domain d3a7ad_: 3a7a D: [245068]
    Other proteins in same PDB: d3a7aa1, d3a7aa2, d3a7ac1, d3a7ac2
    automated match to d3a7la_
    complexed with amp, oct

Details for d3a7ad_

PDB Entry: 3a7a (more details), 3.1 Å

PDB Description: crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein
PDB Compounds: (D:) glycine cleavage system H protein

SCOPe Domain Sequences for d3a7ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a7ad_ b.84.1.1 (D:) Protein H of glycine cleavage system {Escherichia coli K-12 [TaxId: 83333]}
nvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcavae
svkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldatay
eallede

SCOPe Domain Coordinates for d3a7ad_:

Click to download the PDB-style file with coordinates for d3a7ad_.
(The format of our PDB-style files is described here.)

Timeline for d3a7ad_: